HORDB

ID: hor002103
Uniprot ID: P01327
Protein name: Insulin A chain
Gene name: INS
Organism: Chinchilla chinchilla (Short-tailed chinchilla) (Chinchilla brevicaudata)
Family: Insulin family
Source: animal
Expression: NA
Disease: NA
Comments: NA
Taxonomy: Chinchilla (genus), Chinchillidae (family), Hystricomorpha (suborder), Rodentia (order), Glires, Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
GO MF: GO:0005179 hormone activity
GO BP: GO:0005975 carbohydrate metabolic process; GO:0006006 glucose metabolic process; GO:0007165 signal transduction
GO CC: GO:0005576 extracellular region

Sequence: GIVDQCCTSICTLYQLENYCN
Length: 21
Propeptide: FVNKHLCGSHLVDALYLVCGDRGFFYTPMAXXELEDPQVGQADPGVVPEAGRLQPLALEMTLQXXGIVDQCCTSICTLYQLENYCN
Signal peptide: NA
Modification: NA
Glycosylation: NA
Mutagenesis: NA

Function: Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver.
Mechanism: NA
Cross BBB: NA
Target: NA
Target Unid: NA
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor002103_AF2.pdb

hor002103_ESM.pdb

Mass:	274065	Formula:	C99H155N25O35S4
Absent amino acids:	AFHKMPRW	Common amino acids:	C
pI:	3.55	Basic residues:	0
Polar residues:	12	Hydrophobic residues:	5
Hydrophobicity:	21.9	Boman Index:	-1893
Half-Life:	30 hour	Half-Life Yeast:	>20 hour
Half-Life E.Coli:	>10 hour	Aliphatic Index	88.1
Instability Index:	2173.81	Extinction Coefficient cystines:	3230
Absorbance 280nm:	161.5

PubMed ID: 1175610
Title: The relation of conformation and association of insulin to receptor binding; X-ray and circular-dichroism studies on bovine and hystricomorph insulins.